PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS583641.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GRAS
Protein Properties Length: 297aa    MW: 34413.3 Da    PI: 7.997
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS583641.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS238.23.6e-731129585374
          GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                   +++ P+ +++++ a q+I+e v++++++H++Df + +G+QW  L+qaL +R+  +   l+iT++g     s++ +e tg+rL+ fA+ ++vpf+f++
  EcS583641.10  11 HQLVPFSQIQQFSAIQTIMENVAEAKKIHVVDFRLLKGVQWTVLMQALMNRReCSLELLKITAIGT---CSQQVIEDTGKRLETFARLFHVPFSFKI 104
                   5789********************************************9888356679********...689************************* PP

          GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                   ++ +++ +l+ + ++++++E ++V     l+++ +++  l+s    v+k++k+l+P v+ v+e e++hns+ F +rf e l yysa fd+le+ + r
  EcS583641.10 105 IMLQDMLELKEDLFDLDKEEFIVVYARRFLKTMIARPERLKS----VMKVIKKLNPCVMMVTEVESNHNSPAFTHRFPEVLFYYSAYFDCLEECMER 197
                   **********************************88888888....*************************************************** PP

          GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                   ++e+r+++E ++lg+ i+ ++a+eg+er+ r+ +   Wr+ ++++G+ +v l++    qa+l+++k++ +   ++e + ++l++gWk+ p+ s+SaW
  EcS583641.10 198 DDENRTVLESVYLGQGIRTILAAEGEERNIRNIKIDVWRAFFSRFGMVEVDLGTASLYQANLMVKKFPcGSSCTLEMNGKCLIIGWKGTPIHSLSAW 294
                   ********************************************************************9999************************* PP

          GRAS 374 r 374
                   +
  EcS583641.10 295 Q 295
                   6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.2511274IPR005202Transcription factor GRAS
PfamPF035141.2E-7011295IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MRAKPPTMLN HQLVPFSQIQ QFSAIQTIME NVAEAKKIHV VDFRLLKGVQ WTVLMQALMN  60
RRECSLELLK ITAIGTCSQQ VIEDTGKRLE TFARLFHVPF SFKIIMLQDM LELKEDLFDL  120
DKEEFIVVYA RRFLKTMIAR PERLKSVMKV IKKLNPCVMM VTEVESNHNS PAFTHRFPEV  180
LFYYSAYFDC LEECMERDDE NRTVLESVYL GQGIRTILAA EGEERNIRNI KIDVWRAFFS  240
RFGMVEVDLG TASLYQANLM VKKFPCGSSC TLEMNGKCLI IGWKGTPIHS LSAWQFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-351529588375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010064981.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A059DB600.0A0A059DB60_EUCGR; Uncharacterized protein
STRINGPOPTR_0010s15350.11e-125(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM157861014
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-45RGA-like 2